missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FUSIP1 (aa 89-122) Control Fragment Recombinant Protein

Catalog No. RP104490
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104490 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104490 Supplier Invitrogen™ Supplier No. RP104490

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62846 (PA5-62846. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing.This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist.

Specifications

Accession Number O75494
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10772
Name Human FUSIP1 (aa 89-122) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 40 kDa SR-repressor protein; FUS interacting protein (serine/arginine-rich) 1; FUS interacting protein (serine-arginine rich) 1; Fus-associated protein with serine-arginine repeats; FUS-interacting protein (serine-arginine rich) 2; FUS-interacting serine-arginine-rich protein 1; Fusip1; FUSIP2; Neural-salient serine/arginine-rich protein; neural-salient SR protein; neural-specific SR protein; Nssr; NSSR1; NSSR2; PPP1R149; protein phosphatase 1, regulatory subunit 149; serine and arginine rich splicing factor 10; serine/arginine-rich splicing factor 10; serine/arginine-rich splicing factor 13 A; serine-arginine repressor protein (40 kDa); SFRS13; SFRS13A; Splicing factor SRp38; splicing factor, arginine/serine-rich 13; splicing factor, arginine/serine-rich 13 A; SR splicing factor 10; SRp38; SRrp40; Srsf10; Srsf13a; TASR; TASR1; TASR2; TLS-associated protein TASR; TLS-associated protein with Ser-Arg repeats; TLS-associated protein with SR repeats; TLS-associated serine-arginine protein; TLS-associated serine-arginine protein 1; TLS-associated serine-arginine protein 2; TLS-associated SR protein
Common Name FUSIP1
Gene Symbol SRSF10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less