missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FUBP3 (aa 1-56) Control Fragment Recombinant Protein

Catalog No. RP105102
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105102 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105102 Supplier Invitrogen™ Supplier No. RP105102

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84377 (PA5-84377. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression.

Specifications

Accession Number Q96I24
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8939
Name Human FUBP3 (aa 1-56) Control Fragment
Quantity 100 μL
Gene Alias A330051M14Rik; AV006371; far upstream element (FUSE) binding protein 3; far upstream element binding protein 3; far upstream element-binding protein 3; FBP3; FUBP3; FUSE-binding protein 3; MAP2 RNA trans-acting protein 2; Marta2
Common Name FUBP3
Gene Symbol FUBP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less