missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98778

Invitrogen™ Human FTSJD1 (aa 457-548) Control Fragment Recombinant Protein

Catalog No. RP98778
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98778 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98778 Supplier Invitrogen™ Supplier No. RP98778
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61696 (PA5-61696. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap2 2'-O-ribose methylation to the 5'-cap structure of mRNAs. Methylates the ribose of the second nucleotide of a m(7)GpppG-capped mRNA and small nuclear RNA (snRNA) (cap0) to produce m(7)GpppRmpNm (cap2). Recognizes a guanosine cap on RNA independently of its N(7) methylation status. Display cap2 methylation on both cap0 and cap1. Displays a preference for cap1 RNAs.

Specifications

Accession Number Q8IYT2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55783
Name Human FTSJD1 (aa 457-548) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias adrift homolog; AFT; AU022703; C730036L12Rik; cap methyltransferase 2; cap2 2'O-ribose methyltransferase 2; Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2; Cmtr2; FtsJ methyltransferase domain containing 1; ftsJ methyltransferase domain-containing protein 1; ftsjd1; HMTr2; hypothetical protein LOC406742; MTr2; Protein adrift homolog; RGD1309394; wu:fj48c05; zgc:55686
Common Name FTSJD1
Gene Symbol CMTR2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less