missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103994

Invitrogen™ Human FOXL2 (aa 1-38) Control Fragment Recombinant Protein

Catalog No. RP103994
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103994 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103994 Supplier Invitrogen™ Supplier No. RP103994

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FOXL2 is a winged helix/forkhead transcription factor that is highly conserved in human, goat, mouse, and certain aquatic species. Given its cross-species conservation, it appears to play a critical role evolutionarily, likely in ovarian differentiation in mammals and in ovarian somatic cell differentiation and in further follicle development and/or maintenance. Immunohistochemical data shows that FOXL2 is a nuclear protein specifically expressed in eyelids and in fetal and adult ovarian follicular cells. It does not undergo any major posttranslational modifications. FOXL2 is also found to be associated with blepharo-phimosis/ptosis/epicanthus inverses syndrome (BPES). There are two forms of BPES. Type I BPES shows eyelid abnormal-ities that are associated with ovarian failure. In type II BPES, only eyelid defects are found. Studies have shown that FOXL2 is expressed in the mesenchyme of developing mouse eyelids and in adult ovarian follicles.

Specifications

Accession Number P58012
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 668
Name Human FOXL2 (aa 1-38) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AU045128; Blepharophimosis; BPES; BPES1; epicanthus inversus; forkhead box L2; forkhead box protein L2; forkhead transcription factor; forkhead transcription factor FOXL2; forkhead transcription factor L2; Foxl2; LUSTR2; MGC14393; Pfrk; P-Frk; PINTO; pituitary forkhead factor; POF3; putative transcription factor foxl2
Common Name FOXL2
Gene Symbol FOXL2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less