missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106149

Invitrogen™ Human FLT3 (aa 890-985) Control Fragment Recombinant Protein

Catalog No. RP106149
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106149 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106149 Supplier Invitrogen™ Supplier No. RP106149
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111256 (PA5-111256. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FLT3 is a tyrosine protein kinase that is a member of the growth factor receptor tyrosine kinase family. The receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.

Specifications

Accession Number P36888
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2322
Name Human FLT3 (aa 890-985) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B230315G04; CD135; CD135 antigen; fetal liver kinase 2; Fetal liver kinase-2; FL cytokine receptor; FLK2; Flk-2; FLT3; Flt-3; fms related tyrosine kinase 3; FMS-like tyrosine kinase 3; fms-related tyrosine kinase 3; growth factor receptor tyrosine kinase type III; Ly72; OTTHUMP00000214829; Receptor-type tyrosine-protein kinase FLT3; RP11-153M24.3; stem cell tyrosine kinase 1; STK1; STK-1; tyrosine-protein kinase FLT3; tyrosine-protein kinase receptor flk-2; wmfl
Common Name FLT3 (CD135)
Gene Symbol FLT3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less