missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FLIP (aa 6-111) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92580
Description
Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
FLIP (CFLAR) is an apoptosis regulator protein which functions as a crucial link between cell survival and cell death pathways in mammalian cells. It acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.Specifications
| O15519 | |
| Blocking Assay, Control | |
| 8837 | |
| 100 μL | |
| 2310024N18Rik; A430105C05Rik; Cash; CASP8 and FADD like apoptosis regulator; CASP8 and FADD-like apoptosis regulator; CASP8 and FADD-like apoptosis regulator subunit p12; CASP8 and FADD-like apoptosis regulator subunit p43; CASP8AP1; caspase homolog; Caspase-eight-related protein; caspase-like apoptosis regulatory protein; caspase-related inducer of apoptosis; Casper; Cellular FLICE-like inhibitory protein; Cflar; c-Flip; c-FLIPL; c-FLIPR; c-FLIPS; CLARP; ENSMUSG00000072980; FADD-like antiapoptotic molecule 1; FLAME; FLAME1; FLAME-1; Flip; Gm9845; I-FLICE; Inhibitor of FLICE; MACH-related inducer of toxicity; MRIT; testis secretory sperm-binding protein Li 233 m; usurpin; usurpin beta | |
| CFLAR | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FLIP (aa 6-111) Control Fragment | |
| RUO | |
| FLIP | |
| Unconjugated | |
| Recombinant | |
| IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |