missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FKBP15 (aa 542-663) Control Fragment Recombinant Protein

Catalog No. RP89625
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89625 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89625 Supplier Invitrogen™ Supplier No. RP89625

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52495 (PA5-52495. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FKBP15, also known as FKBP133, is a member of the FK506-binding protein family, a group of proteins initially identified as immunophilins, targets for the immunosupressant drugs FK506 and Rapamycin. FKBP15 is expressed in the developing nervous system and contains a domain similar to Wiskott-Aldrich syndrome protein homology region 1 (WH1) in addition to the FK506-binding protein motif. FKBP15 is distributed along the axonal shafts and partially co-localizes with F-actin in the growth cones of dorsal root ganglion neurons; overexpression of FKBP15 resulted in the number of filopodia in transfected neurons, suggesting that FKBP15 modulates growth cone behavior. FKBP15 has also been shown to associate with both microtubules and the actin filament systems and disruption of its expression by RNAi resulted in delayed transport of early endosomes in HeLa cells indicating that FKBP15 is also involved in the transport of early endosomes. At least three isoforms of FKBP15 are known to exist.

Specifications

Accession Number Q5T1M5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23307
Name Human FKBP15 (aa 542-663) Control Fragment
Quantity 100 μL
Gene Alias 133 kDa FK506-binding protein; 133 kDa FKBP; BB131447; C430014M02Rik; FK506 binding protein 15; FK506 binding protein 15, 133 kDa; FK506-binding protein 133; FK506-binding protein 133 kDa; FK506-binding protein 15; FKBO133; Fkbp133; FKBP-133; FKBP15; FKBP-15; Kiaa0674; mKIAA0674; PPP1R76; protein phosphatase 1, regulatory subunit 76; RGD1304816; WAFL; WASP and FKBP-like; WASP- and FKBP-like protein; WASP and FKBP-like protein
Common Name FKBP15
Gene Symbol FKBP15
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less