missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98440

Invitrogen™ Human FKBP11 Control Fragment Recombinant Protein

Catalog No. RP98440
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98440 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98440 Supplier Invitrogen™ Supplier No. RP98440
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59687 (PA5-59687. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PPIases accelerate the folding of proteins during protein synthesis.

Specifications

Accession Number Q9NYL4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51303
Name Human FKBP11 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110002O23Rik; 19 kDa FK506-binding protein; 19 kDa FKBP; FK506 binding protein 11; FK506 binding protein 11, 19 kDa; FK506-binding protein 11; FKBP11; FKBP-11; FKBP19; FKBP-19; peptidyl-prolyl cis-trans isomerase FKBP11; PPIase FKBP11; rotamase; UNQ336/PRO535
Common Name FKBP11
Gene Symbol FKBP11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less