missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FHIT (aa 3-70) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92387
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Alterations and deletions of the FHIT gene are strongly linked to the genesis and establishment of human tumors of the lung, cervix, breast, colon, stomach and pancreas. In normal cells, FHIT may act as a tumor suppressor.Specifications
| P49789 | |
| Blocking Assay, Control | |
| 2272 | |
| 100 μL | |
| AP3A hydrolase; AP3Aase; AW045638; bis(5'-adenosyl)-triphosphatase; bis5'-adenosyl-triphosphatase; Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; dinucleosidetriphosphatase; FHIT; Fra14A2; FRA3B; fragile histidine triad; fragile histidine triad gene; fragile histidine triad protein | |
| FHIT | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FHIT (aa 3-70) Control Fragment | |
| RUO | |
| FHIT | |
| Unconjugated | |
| Recombinant | |
| FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |