missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FGF4 (aa 125-203) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP89876
Description
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52804 (PA5-52804. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Fibroblast growth factor 4 (FGF4) is a member of the fibroblast growth factor (FGF) family that possess broad mitogenic and cell survival activities and play key roles in growth and survival of stem cells during embryogenesis, tissue regeneration, and carcinogenesis. FGF4 was identified by its strong oncogenic transforming activity and is a potent angiogenic factor, expressed in several highly vascularized tumors and also in adult mouse testis, intestine, and brain. Studies on the mouse homolog suggests a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. Furthermore, FGF4 regulates neural progenitor cell proliferation and neuronal differentiation. Recent studies show a growth-promoting role for FGF4 in human embryonic stem cells and a putative feedback inhibition mechanism by a novel FGF4 splice isoform that may serve to promote differentiation at a later stages of development.Specifications
| P08620 | |
| Blocking Assay, Control | |
| 2249 | |
| 100 μL | |
| FGF; FGF4; Fgf-4; Fgfk; Fibroblast growth factor; fibroblast growth factor 4; fibroblast growth factor 4 splice isoform; HBGF-4; heparin secretory transforming protein 1; heparin secretory-transforming protein 1; heparin-binding growth factor 1; heparin-binding growth factor 4; HST; Hst1; hst-1; HSTF1; HSTF-1; human stomach cancer, transforming factor from FGF-related oncogene; kaposi sarcoma oncogene; Kfgf; K-FGF; K-fibroblast growth factor; KS3; oncogene HST; transforming protein KS3 | |
| Fgf4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FGF4 (aa 125-203) Control Fragment | |
| RUO | |
| FGF4 | |
| Unconjugated | |
| Recombinant | |
| VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |