missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89880

Invitrogen™ Human FGF3 (aa 102-223) Control Fragment Recombinant Protein

Catalog No. RP89880
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89880 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89880 Supplier Invitrogen™ Supplier No. RP89880

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52971. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Fibroblast growth factors (FGFs) can stimulate the proliferation of mesenchymal, epithelial and neuroectodermal cells. FGF3 belongs to the heparin binding growth factors family. Members of the family include Acidic FGF (also known as aFGF or FGF 1), basic FGF (bFGF or FGF 2), FGF 3 (also known as Int2) and FGF 4 (also known as hst or Kaposi FGF). FGF 4 was first revealed to be an oncoprotein in Kaposi's sarcoma cells. Other family members include FGF 5, FGF 6, FGF 7 (keratinocyte growth factor, KGF), FGF 8 (AIGF), FGF 9 (GAF) and FGF 10. FGF3 is activated by proviral insertion of mouse mammary tumor virus (MMTV). FGF3 is responsible for most of breast malignancies.

Specifications

Accession Number P11487
Concentration 1.60 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 2248
Name Human FGF3 (aa 102-223) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias FGF; fgf3; FGF-3; fgf3.L; fgf3-A; Fibroblast growth factor; Fibroblast growth factor 3; fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog); fibroblast growth factor 3 L homeolog; Fibroblast growth factor-3; HBGF-3; Heparin-binding growth factor 3; id:ibd5006; INT2; int-2; INT-2 proto-oncogene protein; interacting gene 2; Int-P; lia; murine mammary tumor virus integration site 2, mouse; oncogene INT2; proto-oncogene Int-2; V-INT2 murine mammary tumor virus integration site oncogene homolog; XELAEV_18021863mg; xfgf3; xfgf-3
Common Name FGF3
Gene Symbol FGF3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less