missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FBRS (aa 98-170) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91948
Description
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60615 (PA5-60615. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Fibrosin is a lymphokine secreted by activated lymphocytes that induces fibroblast proliferation.Specifications
| Q9HAH7 | |
| Blocking Assay, Control | |
| 64319 | |
| 100 μL | |
| Fbrs; FBS; FBS1; fbsh; fibrogenic lymphokine; fibrosin; fibrosin 1; fibrosin-1; FLJ11618; probable fibrosin-1; probable fibrosin-1 long transcript protein | |
| Fbrs | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FBRS (aa 98-170) Control Fragment | |
| RUO | |
| FBRS | |
| Unconjugated | |
| Recombinant | |
| LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |