missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101703

Invitrogen™ Human FAT4 (aa 4556-4646) Control Fragment Recombinant Protein

Catalog No. RP101703
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101703 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101703 Supplier Invitrogen™ Supplier No. RP101703

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62694. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAT1, FAT2, FAT3 and FAT4 are human homologs of Drosophila Fat, which is involved in tumor suppression and planar cell polarity (PCP). FAT4 undergo the first proteolytic cleavage by Furin and are predicted to undergo the second cleavage by secretase to release intracellular domain (ICD). FAT4 directly interacts with MPDZ/MUPP1 to recruit membrane associated guanylate kinase MPP5/PALS1. FAT4 is involved in the maintenance of PCP and inhibition of cell proliferation.

Specifications

Accession Number Q6V0I7
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 79633
Name Human FAT4 (aa 4556-4646) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 6030410K14Rik; 9430004M15; Cadherin family member 14; cadherin-related family member 11; CDHF14; CDHR11; FAT atypical cadherin 4; FAT tumor suppressor homolog 4; FAT tumor suppressor homolog 4 (Drosophila); FAT4; Fatj; FAT-J; fat-like cadherin protein FAT-J; hFat4; HKLLS2; Nbla00548; protocadherin Fat 4; putative protein product of Nbla00548; RGD1564291; VMLDS2
Common Name FAT4
Gene Symbol FAT4
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less