missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FAT1 (aa 632-773) Control Fragment Recombinant Protein

Catalog No. RP101001
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101001 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101001 Supplier Invitrogen™ Supplier No. RP101001

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51647 (PA5-51647. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is an ortholog of the Drosophila fat gene, which encodes a tumor suppressor essential for controlling cell proliferation during Drosophila development. The gene product is a member of the cadherin superfamily, a group of integral membrane proteins characterized by the presence of cadherin-type repeats. In addition to containing 34 tandem cadherin-type repeats, the gene product has five epidermal growth factor (EGF)-like repeats and one laminin A-G domain. This gene is expressed at high levels in a number of fetal epithelia. Its product probably functions as an adhesion molecule and/or signaling receptor, and is likely to be important in developmental processes and cell communication. Transcript variants derived from alternative splicing and/or alternative promoter usage exist, but they have not been fully described.

Specifications

Accession Number Q14517
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2195
Name Human FAT1 (aa 632-773) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310038E12Rik; AU023433; Cadherin family member 7; cadherin FAT1 isoform +12; cadherin ME5; cadherin-related family member 8; cadherin-related tumor suppressor homolog; CDHF7; CDHR8; FAT; fat 1 cadherin; FAT atypical cadherin 1; FAT tumor suppressor 1; FAT tumor suppressor homolog 1; FAT tumor suppressor homolog 1 (Drosophila); FAT1; Fath; hFat1; ME5; mFat1; Protein fat homolog; protocadherin Fat 1; Protocadherin Fat 1, nuclear form
Common Name FAT1
Gene Symbol FAT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DGLGAKVSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less