missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108714

Invitrogen™ Human FANCF (aa 231-360) Control Fragment Recombinant Protein

Catalog No. RP108714
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108714 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108714 Supplier Invitrogen™ Supplier No. RP108714

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139733 (PA5-139733. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Fanconi anemia complementation group currently includes FANCA, FANCB, FANCC, FANCD1 , FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ , FANCL, FANCM and FANCN . The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group F.

Specifications

Accession Number Q9NPI8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2188
Name Human FANCF (aa 231-360) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A730016A17; FAF; FANCF; Fanconi anemia complementation group F; Fanconi anemia group F protein; Fanconi anemia, complementation group F; MGC126856; Protein FACF; RGD1561456
Common Name FANCF
Gene Symbol FANCF
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less