missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FAM47B (aa 497-557) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100083
Description
Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61346 (PA5-61346. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
FAM47B is a protein coding gene.Specifications
| Q8NA70 | |
| Blocking Assay, Control | |
| 170062 | |
| 100 μL | |
| FAM47B; family with sequence similarity 47 member B; family with sequence similarity 47, member B; protein FAM47B | |
| FAM47B | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FAM47B (aa 497-557) Control Fragment | |
| RUO | |
| FAM47B | |
| Unconjugated | |
| Recombinant | |
| KIKKANECASRLMYGMELDDMDEVEFLRIKYWDRRRRAAPHSYSAQRGRIRYGPWYFEPKL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |