Learn More
Invitrogen™ Human FAM195B (aa 37-97) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100674
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61029 (PA5-61029. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
- Environmental benefits include:
- Renewable Energy
Specifications
C9JLW8 | |
Blocking Assay, Control | |
348262 | |
100 ÎĽL | |
FAM195B; family with sequence similarity 195 member B; family with sequence similarity 195, member B; GRAN2; Granulin-2; MAPK regulated corepressor interacting protein 1; MAPK regulated co-repressor interacting protein 1; MAPK-regulated co-repressor interacting protein 1; mapk-regulated corepressor-interacting protein 1; MCRIP; MCRIP1; MCRIP1 protein; protein FAM195B | |
MCRIP1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human FAM195B (aa 37-97) Control Fragment | |
RUO | |
FAM195B | |
Unconjugated | |
Recombinant | |
VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |