missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FAM193A (aa 46-147) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100143
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60246 (PA5-60246. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
FAM193A is a protein coding gene.Specifications
| P78312 | |
| Blocking Assay, Control | |
| 8603 | |
| 100 μL | |
| C4orf8; Fam193a; family with sequence similarity 193 member A; family with sequence similarity 193, member A; im:7155132; Protein FAM193A; Protein IT14; RES4-22; RGD1309634 | |
| FAM193A | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FAM193A (aa 46-147) Control Fragment | |
| RUO | |
| FAM193A | |
| Unconjugated | |
| Recombinant | |
| RSISTFLGTLENEHLKKFQVTWELHNKHLFENLVFSEPLLQSNLPALVSQIRLGTTTHDTCSEDTYSTLLQRYQRSEEELRRVAEEWLECQKRIDAYVDEQM | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |