missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FAM178A (aa 139-217) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105077
Description
Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66091 (PA5-66091. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Plays a role in the DNA damage response (DDR) pathway by regulating postreplication repair of UV-damaged DNA and genomic stability maintenance (PubMed:25931565). The SLF1-SLF2 complex acts to link RAD18 with the SMC5-SMC6 complex at replication-coupled interstrand cross-links (ICL) and DNA double-strand breaks (DSBs) sites on chromatin during DNA repair in response to stalled replication forks (PubMed:25931565). Promotes the recruitment of the SMC5-SMC6 complex to DNA lesions (PubMed:25931565).Specifications
| Q8IX21 | |
| Blocking Assay, Control | |
| 55719 | |
| 100 μL | |
| C10orf6; FAM178A; family with sequence similarity 178, member A; protein FAM178A; SLF2; Smc5/6 localization factor 1; SMC5-SMC6 complex localization factor 2; SMC5-SMC6 complex localization factor protein 2 | |
| SLF2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FAM178A (aa 139-217) Control Fragment | |
| RUO | |
| FAM178A | |
| Unconjugated | |
| Recombinant | |
| ASKYLAKGTNIYVPSSYHLPKEMKSLKKKHRSPERRKSLFIHENNEKNDRDRGKTNADSKKQTTVAEADIFNNSSRSLS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |