missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97158

Invitrogen™ Human FAM170B (aa 75-152) Control Fragment Recombinant Protein

Catalog No. RP97158
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97158 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97158 Supplier Invitrogen™ Supplier No. RP97158

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62222 (PA5-62222. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM170B plays a role in fertilization through the acrosome reaction.

Specifications

Accession Number A6NMN3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 170370
Name Human FAM170B (aa 75-152) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4922501K12Rik; Acrosome-related protein; AI449756; C10orf73; Fam170b; family with sequence similarity 170 member B; family with sequence similarity 170, member B; LOW QUALITY PROTEIN: protein FAM170B; protein FAM170B; putative protein FAM170B; rCG42349-like
Common Name FAM170B
Gene Symbol FAM170B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSSESSEYQSYSQYQSCCSCMCDEDNAAPQSVCAFYTHVQTVRGVAVAWETEAGFEPVTRKPRIHEAQFIKRQRWNGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less