missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FAM13C (aa 174-263) Control Fragment Recombinant Protein

Catalog No. RP97104
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97104 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97104 Supplier Invitrogen™ Supplier No. RP97104

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58152 (PA5-58152. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Specifications

Accession Number Q8NE31
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 220965
Name Human FAM13C (aa 174-263) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200015N20Rik; C030038O19Rik; Fam13c; FAM13C1; family with sequence similarity 13 member C; family with sequence similarity 13, member C; family with sequence similarity 13, member C1; mKIAA1796; protein FAM13C; RGD1310149
Common Name FAM13C
Gene Symbol FAM13C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QVHGVKDPAPASTQSVLADGTDSADPSPVHKDGQNEADSAPEDLHSVGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less