missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Factor V (aa 1490-1614) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100492
Description
Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81998 (PA5-81998. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Coagulation factor V (or Proaccelerin) is an essential factor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The active factor V is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in the Factor V gene can result various diseases including Factor V deficiency, thrombophilia due to activated protein C resistance, Budd-Chiari syndrome, Ischemic stroke, and recurrent pregnancy loss.Specifications
| P12259 | |
| Blocking Assay, Control | |
| 2153 | |
| 100 μL | |
| Ac2-120; Activated protein C cofactor; AI173222; Cf5; Cf-5; coagulation factor V; coagulation factor V (proaccelerin, labile factor); Coagulation factor V heavy chain; coagulation factor V jinjiang A2 domain; Coagulation factor V light chain; F5; Factor 5; factor V; factor V Leiden; Factor5; FVL; PCCF; Proaccelerin, labile factor; RPRGL1; THPH2 | |
| F5 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Factor V (aa 1490-1614) Control Fragment | |
| RUO | |
| Factor V | |
| Unconjugated | |
| Recombinant | |
| MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |