missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97168

Invitrogen™ Human EXOSC1 (aa 2-98) Control Fragment Recombinant Protein

Catalog No. RP97168
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97168 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97168 Supplier Invitrogen™ Supplier No. RP97168

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58360 (PA5-58360. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a core component of the exosome. The mammalian exosome is required for rapid degradation of AU rich element-containing RNAs but not for poly(A) shortening. The association of this protein with the exosome is mediated by protein-protein interactions with ribosomal RNA-processing protein 42 and ribosomal RNA-processing protein 46.

Specifications

Accession Number Q9Y3B2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51013
Name Human EXOSC1 (aa 2-98) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610035C18Rik; 2610104C07Rik; 2610312F07Rik; 3'-5' exoribonuclease CSL4 homolog; AI447561; CGI-108; CSL4; Csl4p; EXOSC1; exosomal core protein CSL4; exosome complex component CSL4; Exosome component 1; hCsl4p; homolog of yeast exosomal core protein CSL4; p13; RP11-452K12.9; SKI4; Ski4p
Common Name EXOSC1
Gene Symbol EXOSC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence APPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAIVTCKVSSINSRFAKVHILYVGSMPLKNS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less