missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99916

Invitrogen™ Human Evx2 (aa 57-106) Control Fragment Recombinant Protein

Catalog No. RP99916
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99916 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99916 Supplier Invitrogen™ Supplier No. RP99916

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59632. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EVX2, a protein related to the Drosophila even-skipped (eve), is expressed in limbs like the neighbouring Hoxd genes. Evx-2 functions like a Hoxd gene.

Specifications

Accession Number Q03828
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 344191
Name Human Evx2 (aa 57-106) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias eve, even-skipped homeo box homolog 2; even skipped homeotic gene 2; even skipped homeotic gene 2 homolog; even-skipped homeo box 2 (homolog of Drosophila eve); even-skipped homeobox 2; Evx2; Evx-2; Homeobox even-skipped homolog protein 2; LOW QUALITY PROTEIN: homeobox even-skipped homolog protein 2
Common Name Evx2
Gene Symbol EVX2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less