missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105574

Invitrogen™ Human ETNPPL Isoform 1 (aa 321-401) Control Fragment Recombinant Protein

Catalog No. RP105574
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105574 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105574 Supplier Invitrogen™ Supplier No. RP105574
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67263 (PA5-67263. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the pyridoxal-phosphate-dependent breakdown of phosphoethanolamine, converting it to ammonia, inorganic phosphate and acetaldehyde.

Specifications

Accession Number Q8TBG4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64850
Name Human ETNPPL Isoform 1 (aa 321-401) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1300019H02Rik; Agxt2l1; AI195447; alanine--glyoxylate aminotransferase 2-like 1; alanine-glyoxylate aminotransferase 2-like 1; ethanolamine phosphate phospholyase; ethanolamine-phosphate phospho-lyase; ETNPPL
Common Name ETNPPL Isoform 1
Gene Symbol ETNPPL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less