missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ETEA (aa 217-289) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108582
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111672 (PA5-111672. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is highly expressed in peripheral blood of patients with atopic dermatitis (AD), compared to normal individuals. It may play a role in regulating the resistance to apoptosis that is observed in T cells and eosinophils of AD patients.Specifications
| Q96CS3 | |
| Blocking Assay, Control | |
| 23197 | |
| 100 μL | |
| 2210404d11rik; AI462440; ETEA; expressed in T-cells and eosinophils in atopic dermatitis; FAF2; Fas associated factor family member 2; FAS-associated factor 2; Kiaa0887; mKIAA0887; Protein ETEA; protein expressed in T-cells and eosinophils in atopic dermatitis; RGD1306577; UBX domain containing 8; UBX domain protein 3 B; UBX domain-containing protein 3 B; UBX domain-containing protein 8; UB x 8; UBXD8; UBXN3B; Unknown (protein for MGC:129072) | |
| FAF2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ETEA (aa 217-289) Control Fragment | |
| RUO | |
| ETEA | |
| Unconjugated | |
| Recombinant | |
| EGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |