missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ESX1 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100051
Description
Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62526 (PA5-62526. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Homeobox proteins are transcription factors that contain a helix-turn-helix DNA binding domain termed the homeodomain. ESX1 is an X-linked homeobox gene primarily expressed in the placenta and testis and contains two functional domains: the homeodomain and the proline-rich domain. During embryogenesis, ESX1 is expressed in the extraembryonic tissues, including the endoderm of the visceral yolk sac, the ectoderm of the chorion and the labyrinthine trophoblast of the chorioallantoic placenta. ESX1 can act like a transcriptional repressor to the human oncogene K-ras and treatment of human cancer cells with an ESX1 protein fragment containing the homeodomain reduces the tumorgenicity of cells containing oncogenic K-ras mutations, suggesting ESX1 may be useful as a therapeutic treatment for these cancers.Specifications
| Q8N693 | |
| Blocking Assay, Control | |
| 80712 | |
| 100 μL | |
| ESX homeobox 1; ES x 1; ES x 1 L; ES x 1 R; ES x 1-related protein; ESXR1; extraembryonic spermatogenesis homeobox 1; extraembryonic, spermatogenesis, homeobox 1; extraembryonic, spermatogenesis, homeobox 1 homolog; homeobox protein ES x 1; Homeobox protein ES x 1-C; Homeobox protein ES x 1-N; RP3-513M9.1; Sp x 1 | |
| Esx1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ESX1 Control Fragment | |
| RUO | |
| ESX1 | |
| Unconjugated | |
| Recombinant | |
| HEPEQQQEEPPLLELKQEQEEPPQTTVEGPQPAEGPQTAEGPQPPERKRRRRTAFTQFQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |