missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ESPN (aa 785-848) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94521
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55941 (PA5-55941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimensions, dynamics and signaling capacities of the actin filament-rich, microvillus-type specializations that mediate sensory transduction in variouS mechanosensory and chemosensory cells.Specifications
| B1AK53 | |
| Blocking Assay, Control | |
| 83715 | |
| 100 μL | |
| actin cytoskeletal regulatory protein; autosomal recessive deafness type 36 protein; DFNB36; Ectoplasmic specialization protein; espin; Espn; je; jerker; Jerker, deafness locus; LP2654 | |
| Espn | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ESPN (aa 785-848) Control Fragment | |
| RUO | |
| ESPN | |
| Unconjugated | |
| Recombinant | |
| SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |