missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92411

Invitrogen™ Human ERGIC1 (aa 127-189) Control Fragment Recombinant Protein

Catalog No. RP92411
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92411 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92411 Supplier Invitrogen™ Supplier No. RP92411

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53874 (PA5-53874. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of ERGIC1 remains largely unknown. ERGIC1 was highly expressed in most primary prostate tumors. It is an intriguing potential drug target especially for the ERG oncogene expressing tumors.

Specifications

Accession Number Q969X5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57222
Name Human ERGIC1 (aa 127-189) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200007D18Rik; endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1; endoplasmic reticulum-golgi intermediate compartment 1; endoplasmic reticulum-golgi intermediate compartment 32 kDa protein; endoplasmic reticulum-Golgi intermediate compartment protein 1; ERGIC1; ERGIC32; ERGIC-32; ER-Golgi intermediate compartment 32 kDa protein; HT034; KIAA1181; maa-136; mKIAA1181 protein-like; NET24
Common Name ERGIC1
Gene Symbol ERGIC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYIL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less