missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105683

Invitrogen™ Human ErbB2 (HER-2) Control Fragment Recombinant Protein

Catalog No. RP105683
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105683 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105683 Supplier Invitrogen™ Supplier No. RP105683

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ErbB2 (HER2) is a receptor tyrosine kinase that is overexpressed in some breast tumors. Herceptin, used in treatment of metastatic Her2-positive cancer, is monoclonal antibody targeting this kinase.

Specifications

Accession Number P04626
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 2064
Name Human ErbB2 (HER-2) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias avian erythroblastosis oncogene B 2; Avian erythroblastosis viral (v-erb-B2) oncogene homologue 2 (neuro/glioblastoma derived oncogene homolog); CD antigen CD340; CD340; c-erb B2/neu protein; c-erbB2; C-erbB-2; c-neu; epidermal growth factor receptor-related protein; erbb 2; ERBB2; erb-b2; Erbb-2; ErbB2 (pTyr1139); ErbB2 (pY1139); ErbB2 phospho Y1139; erb-b2 receptor tyrosine kinase 2; her 2; HER2; HER-2; HER-2/neu; herstatin; human epidermal growth factor receptor 2; Kiaa3023; metas; Metastatic lymph node gene 19 protein; mKIAA3023; MLN 19; MLN19; NEU; Neu oncogene; NEU proto-oncogene; neuro/glioblastoma derived oncogene homolog; neuroblastoma/glioblastoma derived oncogene homolog; NGL; p185erbB2; p185neu; phospho ErbB2; proto-oncogene c-ErbB-2; Proto-oncogene Neu; receptor tyrosine-protein kinase erbB-2; TKR1; Tyrosine kinase-type cell surface receptor HER2; v-erb-b2 avian erythroblastic leukemia viral oncogene 2; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2; v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Common Name Her-2 (ErbB2)
Gene Symbol ERBB2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDGAPHR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less