missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99080

Invitrogen™ Human EPS8L1 Control Fragment Recombinant Protein

Catalog No. RP99080
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99080 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99080 Supplier Invitrogen™ Supplier No. RP99080

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59755. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eps8L1 (EPS8-like 1), also known as DRC3 or EPS8R1, is a 723 amino acid protein that localizes to the cytoplasm and belongs to the Eps8 (epidermal growth factor receptor pathway substrate 8) family. Expressed in placental tissue, Eps8L1 functions to stimulate the guanine exchange activity of Sos 1 (son of sevenless homolog 1), a protein that promotes the exchange of Ras-bound GDP for GTP. Additionally, Eps8L1 is thought to associate with Actin and, via this association, may play a role in membrane ruffling and remodeling of the Actin cytoskeleton. Through its ability to regulate protein activation and cytoskeleton dynamics, Eps8L1 may participate in cell growth and differentiation events within the cell. Eps8L1 contains one SH3 domain and is expressed as four isoforms due to alternative splicing events.

Specifications

Accession Number Q8TE68
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 54869
Name Human EPS8L1 Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2310051G19Rik; 4632407K17Rik; AW060268; DRC3; Epidermal growth factor receptor kinase substrate 8-like protein 1; epidermal growth factor receptor pathway substrate 8-related protein 1; EPS8 like 1; Eps8l1; EPS8-like 1; EPS8-like protein 1; Eps8r1; EPS8-related protein 1; PP10566
Common Name EPS8L1
Gene Symbol EPS8L1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEFFSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVAVNGHRDLEPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less