missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106483

Invitrogen™ Human ENPP2 (aa 326-413) Control Fragment Recombinant Protein

Catalog No. RP106483
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106483 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106483 Supplier Invitrogen™ Supplier No. RP106483

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65809 (PA5-65809. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

Accession Number Q13822
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5168
Name Human ENPP2 (aa 326-413) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ATX; ATX-X; autotaxin; AutotaxinATX; autotaxin-t; ectonucleotide pyrophosphatase/phosphodiesterase 2; ectonucleotide pyrophosphatase/phosphodiesterase family member 2; E-NPP 2; Enpp2; Extracellular lysophospholipase D; FLJ26803; lysoPLD; NPP2; Npps2; PD-IALPHA; PDNP2; phosphodiesterase I/nucleotide pyrophosphatase 2; phosphodiesterase I/nucleotide pyrophosphatase 2 (autotaxin); plasma lysophospholipase D
Common Name ENPP2
Gene Symbol ENPP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less