missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93713

Invitrogen™ Human ENO3 (aa 223-324) Control Fragment Recombinant Protein

Catalog No. RP93713
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93713 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93713 Supplier Invitrogen™ Supplier No. RP93713
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81894 (PA5-81894. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described.

Specifications

Accession Number P13929
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2027
Name Human ENO3 (aa 223-324) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2-phospho-D-glycerate hydrolyase; 2-phospho-D-glycerate hydro-lyase; BBE; beta beta enolase; beta-enolase; cb883; ENO1; ENO3; Eno-3; eno3 protein; enob; enolase 1, (alpha); enolase 3; enolase 3 (beta, muscle); enolase 3, (beta, muscle); enolase 3, beta muscle; enolase 3, beta, muscle; fj24f12; GSD13; hypothetical protein LOC540303; MSE; muscle enriched enolase; Muscle specific enolase (beta beta enolose) (two splicing products); muscle-specific enolase; Skeletal muscle enolase; wu:fj24f12
Common Name ENO3
Gene Symbol ENO3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less