missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106150

Invitrogen™ Human EMC7 (aa 52-157) Control Fragment Recombinant Protein

Catalog No. RP106150
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106150 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106150 Supplier Invitrogen™ Supplier No. RP106150
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65474 (PA5-65474. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EMC7 (ER Membrane Protein Complex Subunit 7) is a Protein Coding gene. Diseases associated with EMC7 include Cone-Rod Dystrophy, X-Linked, 1. Gene Ontology (GO) annotations related to this gene include carbohydrate binding. [GeneCards]

Specifications

Accession Number Q9NPA0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56851
Name Human EMC7 (aa 52-157) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2900064A13Rik; AI451465; c11orf3; C15orf24; chromosome 15 hypothetical ATG/GTP binding protein; Emc7; ER membrane protein complex subunit 7; HT022; ORF1-FL1; Orf3; UNQ905/PRO1926; UPF0480 protein C15orf24; UPF0480 protein C15orf24 homolog
Common Name EMC7
Gene Symbol EMC7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less