missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96918

Invitrogen™ Human ELOVL7 (aa 1-31) Control Fragment Recombinant Protein

Catalog No. RP96918
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96918 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96918 Supplier Invitrogen™ Supplier No. RP96918

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57615 (PA5-57615. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lipogenesis is a key event in the energy storage system and is controlled by the transcription factor sterol regulatory element-binding protein (SREBP)-1. Elongation of very long chain fatty acids protein 7 (ELOVL7) is a member of fatty acyl-CoA elongase gene family that elongates saturated very-long-chain fatty acids (SVLFA, C20:0-) and has been suggested to be involved in prostate cancer growth through saturated long-chain fatty acid metabolism. The metabolic pathways of long-chain fatty acids play an important role in the maintenance of membrane lipid composition and the generation of cell signaling precursor molecules such as eicosanoids and sphingosine-1 phosphate. Overexpression of ELOVL7 results in lipid accumulation in differentiated adipocytes; its expression is regulated by the microRNA miR-219.

Specifications

Accession Number A1L3X0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79993
Name Human ELOVL7 (aa 1-31) Control Fragment
Quantity 100 μL
Gene Alias 3-keto acyl-CoA synthase Elovl7; 9130013K24Rik; AI840082; elongation of very long chain fatty acids protein 7; elongation of very long chain fatty acids-like 7; ELOVL FA elongase 7; ELOVL family member 7, elongation of long chain fatty acids; ELOVL family member 7, elongation of long chain fatty acids (yeast); ELOVL fatty acid elongase 7; ELOVL7; Very long chain 3-ketoacyl-CoA synthase 7; very long chain 3-oxoacyl-CoA synthase 7; very-long-chain 3-oxoacyl-CoA synthase 7
Common Name ELOVL7
Gene Symbol ELOVL7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAFSDLTSRTVHLYDNWIKDADPRVEDWLLM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less