missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human eIF3f (aa 104-174) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100070
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61918 (PA5-61918. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.Specifications
| O00303 | |
| Blocking Assay, Control | |
| 8665 | |
| 100 μL | |
| 0610037M02Rik; AA409853; deubiquitinating enzyme eIF3f; eIF3 p47; eIF-3-epsilon; eIF3-epsilon; EIF3F; eIF3-p47; Eif3s5; eukaryotic translation initiation factor 3 subunit 5; eukaryotic translation initiation factor 3 subunit 5 epsilon; eukaryotic translation initiation factor 3 subunit F; eukaryotic translation initiation factor 3, subunit 5 (epsilon); eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47 kD); eukaryotic translation initiation factor 3, subunit 5 epsilon, 47 kDa; eukaryotic translation initiation factor 3, subunit F | |
| EIF3F | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human eIF3f (aa 104-174) Control Fragment | |
| RUO | |
| eIF3f | |
| Unconjugated | |
| Recombinant | |
| DSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |