missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human EIF2S1 (aa 230-302) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104196
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
EIF2a (Eukaryotic translation initiation factor 2A) is a heterotrimer composed of three subunits (alpha, beta, and gamma). This translation initiation factor drives binding of initiator methionyl-tRNA to the 40S ribosome in an AUG-dependent manner to form the 43S pre-initiation complex. The polypeptide can be phosphorylated by related protein kinases activated in response to stress. Phosphorylated EIF2A inhibits EIF2B activity and prevents guanine nucleotide exchange.Specifications
| P05198 | |
| Blocking Assay, Control | |
| 1965 | |
| 100 μL | |
| 0910001O23Rik; 2410026C18Rik; 35 kDa; EIF2; EIF-2; eIF2 alpha; eIF2 alpha subunit; EIF2A; eIF-2 A; eIF2alpha; EIF-2 alpha; eIF-2-alpha; EIF2S1; eif2s1b; Eukaryotic translation initiation factor 2 subunit 1; eukaryotic translation initiation factor 2 subunit 1 b; eukaryotic translation initiation factor 2 subunit alpha; eukaryotic translation initiation factor 2, subunit 1 alpha; eukaryotic translation initiation factor 2, subunit 1 alpha b; eukaryotic translation initiation factor 2, subunit 1 alpha, 35 kDa; eukaryotic translation initiation factor 2 A; fb19d01; translation initiation factor subunit; wu:fb19d01 | |
| EIF2S1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human EIF2S1 (aa 230-302) Control Fragment | |
| RUO | |
| EIF2S1 | |
| Unconjugated | |
| Recombinant | |
| IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |