missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human EFR3B (aa 457-525) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109266
Description
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139908 (PA5-139908. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Component of a complex required to localize phosphatidylinositol 4-kinase (PI4K) to the plasma membrane. The complex acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis (Probable). In the complex, EFR3B probably acts as the membrane-anchoring component. Also involved in responsiveness to G-protein-coupled receptors; it is however unclear whether this role is direct or indirect.Specifications
| Q9Y2G0 | |
| Blocking Assay, Control | |
| 22979 | |
| 100 μL | |
| AI852640; C030014M07Rik; EFR3 homolog B; EFR3 homolog B (S. cerevisiae); Efr3b; FLJ37871; Kiaa0953; mKIAA0953; Protein EFR3 homolog B; RGD1310845 | |
| EFR3B | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human EFR3B (aa 457-525) Control Fragment | |
| RUO | |
| EFR3B | |
| Unconjugated | |
| Recombinant | |
| DRLLSTALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVLKLKVDKCSRQDTVFMKKHSQQL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |