missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101863

Invitrogen™ Human ECH1 (aa 197-325) Control Fragment Recombinant Protein

Catalog No. RP101863
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101863 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101863 Supplier Invitrogen™ Supplier No. RP101863
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82220 (PA5-82220. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.

Specifications

Accession Number Q13011
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1891
Name Human ECH1 (aa 197-325) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA617331; delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; delta3,5-delta2,4-dienoyl-CoA isomerase; delta3,5-delta2,4-dienoyl-coenzyme A isomerase; dienoyl-CoA isomerase; ECH1; enoyl CoA hydratase 1, peroxisomal; enoyl coenzyme A hydratase 1, peroxisomal; enoyl hydratase-like protein peroxisomal; enoyl hydratase-like protein, peroxisomal; enoyl-CoA hydratase 1; enoyl-CoA hydratase 1, peroxisomal; HPXEL; Peroxisomal enoyl hydratase-like protein; peroxisomal enoyl-CoA hydratase 1; peroxisomal/mitochondrial dienoyl-CoA isomerase; Pxel
Common Name ECH1
Gene Symbol ECH1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less