missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98049

Invitrogen™ Human E6AP (aa 31-112) Control Fragment Recombinant Protein

Catalog No. RP98049
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98049 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98049 Supplier Invitrogen™ Supplier No. RP98049

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UBE3A (ubiquitin-protein ligase E3A, AKA E6AP) is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the ARNTL/BMAL1, ARC, RAD23A, RAD23B, MCM7, annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B. Additionally, UBE3A may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. UBE3A also plays an important role in the regulation of the circadian clock. Defects in UBE3A are a cause of Angelman syndrome (AS).

Specifications

Accession Number Q05086
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 7337
Name Human E6AP (aa 31-112) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4732496B02; 5830462N02Rik; A130086L21Rik; ANCR; AS; CTCL tumor antigen se37-2; E6AP; E6-AP; E6-AP ubiquitin protein ligase; E6AP ubiquitin-protein ligase; EPVE6AP; FLJ26981; HECT-type ubiquitin transferase E3A; HPVE6A; human papilloma virus E6-associated protein; human papillomavirus E6-associated protein; mKIAA4216; oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; UBE3A; ubiquitin conjugating enzyme E3A; ubiquitin protein ligase E3A; ubiquitin-protein ligase E3A
Common Name E6AP
Gene Symbol UBE3A
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less