missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DTX1 (aa 361-407) Control Fragment Recombinant Protein

Catalog No. RP105011
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105011 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105011 Supplier Invitrogen™ Supplier No. RP105011

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84249 (PA5-84249. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity.

Specifications

Accession Number Q86Y01
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1840
Name Human DTX1 (aa 361-407) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias deltex 1; deltex 1 homolog (Drosophila); deltex 1, E3 ubiquitin ligase; deltex E3 ubiquitin ligase 1; deltex homolog 1; delte x 1; DT x 1; E3 ubiquitin-protein ligase DT x 1; fractionated x-irradiation induced transcript 1; Fxit1; FXI-T1; hDT x 1; hDx-1; mDT x 1; mKIAA4160; protein deltex-1; RING-type E3 ubiquitin transferase DT x 1
Common Name DTX1
Gene Symbol Dtx1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less