missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DTWD2 (aa 168-262) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100227
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62751 (PA5-62751. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
DTWD2 is a protein coding gene.Specifications
| Q8NBA8 | |
| Blocking Assay, Control | |
| 285605 | |
| 100 μL | |
| 1190002H09Rik; 8030470C17Rik; AI414673; BB115449; DTW domain containing 2; DTW domain-containing protein 2; Dtwd2 | |
| DTWD2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DTWD2 (aa 168-262) Control Fragment | |
| RUO | |
| DTWD2 | |
| Unconjugated | |
| Recombinant | |
| PVYPSTIIIIDGTWSQAKDIFYKNSLFRHPKQVQLKTSISSQYVIRMQPTNRCLSTLECAAVALSILEKNNYIQETLLRPLQALCSFQLQHGAQI | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |