missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94607

Invitrogen™ Human DTNBP1 (aa 94-160) Control Fragment Recombinant Protein

Catalog No. RP94607
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94607 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94607 Supplier Invitrogen™ Supplier No. RP94607
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82998 (PA5-82998. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dtnbp1 may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations are associated with Hermansky-Pudlak syndrome type 7. This protein may also be associated with schizophrenia.

Specifications

Accession Number Q96EV8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84062
Name Human DTNBP1 (aa 94-160) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5430437B18Rik; AW048963; biogenesis of lysosomal organelles complex-1, subunit 8; biogenesis of lysosome-related organelles complex 1 subunit 8; BLOC-1 subunit 8; Bloc1s8; DBND; distrobrevin binding protein 1; DKFZp564K192; DTBP1; Dtnbp1; Dysbindin; dysbindin-1; dystrobrevin binding protein 1; dystrobrevin-binding protein 1; FLJ30031; Hermansky-Pudlak syndrome 7 protein; hermansky-Pudlak syndrome 7 protein homolog; HPS7; HPS7 protein; HPS7 protein homolog; Hps7-like protein; MGC20210; My031; OTTHUMP00000221462; OTTHUMP00000221485; RP1-147M19.1; sandy; sdy
Common Name DTNBP1
Gene Symbol DTNBP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less