missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DSCC1 (aa 298-391) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP93796
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54885 (PA5-54885. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CHTF18 (MIM 613201), CHTF8 (MIM 613202), and DSCC1 arecomponents of an alternative replication factor C (RFC) (see MIM600404) complex that loads PCNA (MIM 176740) onto DNA during Sphase of the cell cycle.Specifications
| Q9BVC3 | |
| Blocking Assay, Control | |
| 79075 | |
| 100 μL | |
| 2010006I05Rik; 2600005O03Rik; DCC1; defective in sister chromatid cohesion 1 homolog; defective in sister chromatid cohesion 1 homolog (S. cerevisiae); defective in sister chromatid cohesion protein 1 homolog; DNA replication and sister chromatid cohesion 1; DSCC1; RGD1561749; Sister chromatid cohesion protein DCC1; UNQ9337/PRO34008 | |
| DSCC1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DSCC1 (aa 298-391) Control Fragment | |
| RUO | |
| DSCC1 | |
| Unconjugated | |
| Recombinant | |
| EGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTEEDIAPYIQDLCGEKQTIGALLTKYSHSSMQNGVKVYNSRRP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |