missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DRAK2 (aa 286-371) Control Fragment Recombinant Protein

Catalog No. RP97244
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97244 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97244 Supplier Invitrogen™ Supplier No. RP97244

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83247 (PA5-83247. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STK17B (also known as DRAK2) is a member of the serine/threonine kinase family and is related to death-associated protein kinase that triggers apoptosis. STK17B is selectively important for T-cell survival and inhibition of STK17B has therapeutic potential for autoimmune disease. T-cell survival depends on a balance of T-cell receptor and co-stimulatory signals and deficiency of STK17B can affect autoimmune disease susceptibility without generalized suppression of the immune system. Protein kinases play important roles in the signal transduction in response to a variety of external stimuli. Recently, several protein kinases have been identified that may also be involved in apoptotic process. Overexpression of a serine/threonine kinase, ZIP kinase can cause the morphological changes typical of apoptosis in NIH 3T3 cells. Sanjo et al, have identified two new protein kinases DRAK1 and DRAK2 (Death Receptor Associated Kinase 1 and 2). Both DRAKs and ZIP kinase share significant homology at the amino acid level. The kinase domains of both DRAKs, ZIP kinase are homologous to DAP (Death-associated protein) kinase, which is involved in the apoptotic signaling induced by interferon-g. Overexpression of DRAKs in NIH 3T3 cells lead to apoptosis. These transfection experiments suggest that C-terminal domain of DRAKs are important for induction of apoptosis.

Specifications

Accession Number O94768
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9262
Name Human DRAK2 (aa 286-371) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110009A03Rik; AI120141; DAP kinase-related apoptosis-inducing protein kinase 2; death-associated protein kinase-related 2; DRAK 2; DRAK2; serine/threonine kinase 17 b; serine/threonine kinase 17 b (apoptosis-inducing); serine/threonine-protein kinase 17 B; ST17B; STK 17 B; Stk17b
Common Name DRAK2
Gene Symbol STK17B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less