missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101934

Invitrogen™ Human DOCK11 Control Fragment Recombinant Protein

Catalog No. RP101934
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101934 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101934 Supplier Invitrogen™ Supplier No. RP101934

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63767 (PA5-63767. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Small GTPases of the Rho family, Rho, Rac, and Cdc42, are critical regulators of the actin cytoskeleton and many other cellular processes. Rho GTPases are activated by Dbl-homology (DH)-domain-containing guanine nucleotide exchange factors (GEFs). DOCK 11 (dedicator of cytokinesis 11), also known as ACG or ZIZ2 (zizimin2), is a 2073 amino acid protein belonging to the DOCK family of cytokinesis-regulating proteins that is mainly expressed in peripheral blood leukocytes. DOCK 11 functions as a GEF that binds and activates Cdc42 by exchanging bound GDP for free GTP. Cdc42 mediates cell polarity, gene expression, cell cycle progression and cell-cell contacts. Similar to other DOCK family members, DOCK 11 contains a PH domain and two internal DOCK homology regions designated DHR1 and DHR2.

Specifications

Accession Number Q5JSL3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 139818
Name Human DOCK11 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5033414A21Rik; 8030476J24; ACG; activated Cdc42-associated guanine nucleotide exchange factor; Activated Cdc42-associated guanine nucleotide exchange factor, ACG; bB128O4.1; bB128O4.1.1 (novel protein); dedicator of cytokinesis 11; dedicator of cytokinesis protein 11; Dock11; DOCK-11; sph238; spleen specific 238 kDa protein with PH domain; ZIZ2; Zizimin 2; zizimin2; Zizimin-2
Common Name DOCK11
Gene Symbol DOCK11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KDTVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less