missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103894

Invitrogen™ Human DNAJB6 (aa 232-302) Control Fragment Recombinant Protein

Catalog No. RP103894
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103894 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103894 Supplier Invitrogen™ Supplier No. RP103894

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63592 (PA5-63592. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described.

Specifications

Accession Number O75190
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10049
Name Human DNAJB6 (aa 232-302) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DJ4; DnaJ; DnaJ (Hsp40) homolog, subfamily B, member 6; DnaJ heat shock protein family (Hsp40) member B6; dnaJ homolog subfamily B member 6; DNAJB6; dnajb6 {ECO:0000312; DnaJ-like 2 protein; EMBL:AAH78908.1, ECO:0000312; Heat shock protein J2; HHDJ1; Hsj2; HSJ-2; Hsp40 homolog; LGMD1D; LGMD1E; mammalian relative of DnaJ; mDj4; MRJ; MSJ1; MSJ-1; RGD:1308207}
Common Name DNAJB6
Gene Symbol DNAJB6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAGLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less