missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108452

Invitrogen™ Human DNAJB13 (aa 86-149) Control Fragment Recombinant Protein

Catalog No. RP108452
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108452 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108452 Supplier Invitrogen™ Supplier No. RP108452
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84489 (PA5-84489. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNAJA13 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins.

Specifications

Accession Number P59910
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 374407
Name Human DNAJB13 (aa 86-149) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700014P03Rik; DnaJ (Hsp40) homolog, subfamily B, member 13; DnaJ (Hsp40) related, subfamily B, member 13; DnaJ heat shock protein family (Hsp40) member B13; dnaJ homolog subfamily B member 13; DNAJB13; DnaJ-like protein; radial spoke 16 homolog A; RSPH16A; spermatogenesis apoptosis-related protein; testis and spermatogenesis cell-related protein 6; Testis spermatocyte apoptosis-related gene 6 protein; testis spermatogenesis apoptosis related protein 1; testis spermatogenesis apoptosis-related gene 3 protein; Testis spermatogenesis apoptosis-related gene 6 protein; testis spermatogenesis apoptosis-related protein 1; testis spermatogenesis apoptosis-related protein 6; Tsarg; Tsarg1; TSARG3; TSARG5; TSARG6
Common Name DNAJB13
Gene Symbol DNAJB13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less