missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DLX5 (aa 7-140) Control Fragment Recombinant Protein

Catalog No. RP102491
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102491 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102491 Supplier Invitrogen™ Supplier No. RP102491
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82204 (PA5-82204. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a homeobox transcription factor gene family similar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.

Specifications

Accession Number P56178
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1749
Name Human DLX5 (aa 7-140) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI385752; distal-less homeo box 5; distal-less homeobox 5; distal-less homeobox protein 5; DLX-3; DL x 5; Homeobox protein DLX-3; homeobox protein DLX-5; RDLX; SHFM1D; split hand/foot malformation type 1 with sensorineural hearing loss; Unknown (protein for MGC:137934)
Common Name DLX5
Gene Symbol DLX5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less