missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DLG7 (aa 7-141) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP88858
Description
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82197 (PA5-82197. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells and mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. The protein is also a key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.Specifications
| Q15398 | |
| Blocking Assay, Control | |
| 9787 | |
| 100 μL | |
| C77459; C86398; DAP-5; discs large homolog 7; discs large homolog associated protein 5; discs, large (Drosophila) homolog-associated protein 5; discs, large homolog 7; discs, large homolog-associated protein 5; disks large-associated protein 5; Disks large-associated protein DLG7; DLG associated protein 5; DLG7; DLGAP5; Hepatoma up-regulated protein; hepatoma up-regulated protein homolog; HURP; Kiaa0008; mKIAA0008 | |
| DLGAP5 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DLG7 (aa 7-141) Control Fragment | |
| RUO | |
| DLG7 | |
| Unconjugated | |
| Recombinant | |
| ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |